- CD300a/LMIR1 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-84431
- CLM-8, CMRF-35-H9, CMRF-35H, CMRF35-H, CMRF35-H9, CMRF35H, CMRF35H9, IGSF12, IRC1, IRC1/IRC2, IRC2, IRp60
- Human
- This antibody was developed against Recombinant Protein corresponding to amino acids: SGDHSELSQN PKQASPREEL HYASVVFDSN TNRIAAQRPR EEEPDSDYSV IRK
- Unconjugated
- PBS (pH 7.2) and 40% Glycerol
- CD300a/LMIR1
- Rabbit
- 0.1 ml (also 25 ul)
- Immunohistochemistry, Immunohistochemistry-Paraffin
- CD300a molecule
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Mast Cell Markers
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
SGDHSELSQNPKQASPREELHYASVVFDSNTNRIAAQRPREEEPDSDYSVIRK
Specifications/Features
Available conjugates: Unconjugated